PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_002547
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family SBP
Protein Properties Length: 976aa    MW: 107974 Da    PI: 6.4106
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_002547genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP128.23.2e-40126203178
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                  +Cqv++C+adls+ak+yhrrhkvC vhska++++v   +qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrrk+++
  DCAR_002547 126 VCQVDDCRADLSSAKDYHRRHKVCAVHSKATKAMVGSAMQRFCQQCSRFHLLQEFDEGKRSCRRRLAGHNKRRRKTHP 203
                  6**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.0E-32120188IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.735124201IPR004333Transcription factor, SBP-box
SuperFamilySSF1036127.98E-37126204IPR004333Transcription factor, SBP-box
PfamPF031107.0E-29127200IPR004333Transcription factor, SBP-box
CDDcd002043.50E-7742861No hitNo description
SuperFamilySSF484034.82E-9744863IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.201.3E-6755865IPR020683Ankyrin repeat-containing domain
PROSITE profilePS500888.549801822IPR002110Ankyrin repeat
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 976 aa     Download sequence    Send to blast
MEWDLNDWKW DGDQFTAAPL RSVAADCRSR QFFPIGPEIP VVTGLSNSSS SCSEEIDLRN  60
EREQRELEKR RRVFVVDDDE LDDESGSLNL NLGGMVYPVA NGEVENWNGK SGKKTKLGGS  120
ASSGAVCQVD DCRADLSSAK DYHRRHKVCA VHSKATKAMV GSAMQRFCQQ CSRFHLLQEF  180
DEGKRSCRRR LAGHNKRRRK THPENSNTGV PVNDELSNSY LLISLLRILS NMHTDSSDQM  240
KDQDLLSHLL KNLASVAGTI NEGNLSGLLN GSSKLQLQNF VASRGQQLSR PTGQCTVMPS  300
SGMTQKREFV DNVSGGKFQT PPAQLSNIHF PTKDCIAANA NASNAKMEST KELNFDLNDV  360
YDDSEECMEP LERSDAPICV ENGSAGYPIW IHQDSDKSSP PQTSGNSGSL STQSPSSSSG  420
EAQLVQVRTD RIVFKLFGKN PSEFPLVLRS QILGWLAHSP TDIESYIRPG CVILTIYLRM  480
EKSTWEVVCS DLSFSLRKLL DSDSFWKEGW IYTRVQNRVA FVHDGEVVLD TQLTVTNDKN  540
CNISSIRPIA VTVSENANFL VKGSNMSQST RILCALEGMY LVQQSCSELM DGCGSLSESD  600
KGQSLSFPCS IPNVMGRGFI EVEDQTLGTS FFPFIVAEKD VCSEICTLES ALELAETTSG  660
IKGETEHLEV HDQALEFVHE MGWLLHRTQL KIRLGPNDPN LDLFSFKRFR YLMEFSLDHD  720
WCAVVKKLLC ILFSGIVDSG EHPNIERALL DIGLLHRAVQ RNCRPMVQAL LSFIPANVID  780
KYGPEQTLPG HIFRPDSAGP GGLTPLHIAA SSGGYETVLD ALTDDPQMVG LEAWKNARDG  840
AGLTPHDYAF QRGCHSYINM IQKKTKTRSG QGHVVVDIPG TIKQKLPGGP KPTEVSSFQT  900
EKAIMKLVQS NCNLCEQKLA YGNYRRSLAS YRPAMLAMVA IAAVCVCVAL LFKSSPEVLY  960
VFQPFRWEHL KFGSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-31118200184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16872KRRRV
2195201KRRRKTH
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00633PBMTransfer from PK06791.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002274934.10.0PREDICTED: squamosa promoter-binding-like protein 1
TrEMBLF6HE380.0F6HE38_VITVI; Putative uncharacterized protein
STRINGVIT_05s0020g00700.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18712466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.10.0squamosa promoter binding protein-like 1